missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ATP5E (Human) Recombinant Protein
Human ATP5E full-length ORF ( AAH01690, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00000514-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Specifica
AAH01690 | |
ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ATP5E | |
GST |
514 | |
Wheat germ expression system | |
25 μg | |
ATPE, MGC104243 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto