missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ATP5G1 (Human) Recombinant Protein
Human ATP5G1 full-length ORF ( AAH04963, 18 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
344.00€ - 521.00€
Specifica
| Numero di accesso | AAH04963 |
|---|---|
| ID gene (immissione) | 516 |
| Nome | ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) |
| Metodo di preparazione | Wheat germ expression system |
| Analisi di controllo qualità | 125% SDS-PAGE Stained with Coomassie Blue |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16162051
|
Abnova™
H00000516-P01.10ug |
10 μg |
344.00€
10µg |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
16172051
|
Abnova™
H00000516-P01.25ug |
25 μg |
521.00€
25µg |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
- Sequence: TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Specifica
| AAH04963 | |
| ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| ATP5A, ATP5G | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 516 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ATP5G1 | |
| GST |
Sicurezza e movimentazione
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto