missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ETF1 (Human) Recombinant Protein
Human ETF1 partial ORF ( NP_004721.1, 338 a.a. - 437 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00002107-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Specifica
NP_004721.1 | |
eukaryotic translation termination factor 1 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ETF1 | |
GST |
2107 | |
Wheat germ expression system | |
10 μg | |
D5S1995, ERF, ERF1, MGC111066, RF1, SUP45L1, TB3-1 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto