missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FXR1 (Human) Recombinant Protein
Human FXR1 partial ORF ( AAH28983, 121 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00008087-Q01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFH
Specifica
AAH28983 | |
fragile X mental retardation, autosomal homolog 1 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
8087 | |
Wheat germ expression system | |
10 μg | |
FXR1 | |
GST |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto