missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Glut2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
443.00€ - 600.00€
Specifica
| Antigene | Glut2 |
|---|---|
| Diluizione | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applicazioni | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classificazione | Polyclonal |
| Coniugato | Unconjugated |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
18668636
|
Novus Biologicals
NBP2-48586 |
0.1 mL |
600.00€
0.10mL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
18614347
|
Novus Biologicals
NBP2-48586-25ul |
25 μL |
443.00€
25µL |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
Glut2 Polyclonal antibody specifically detects Glut2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifica
| Glut2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism, Stem Cell Signaling Pathway | |
| PBS (pH 7.2), 40% Glycerol | |
| 6514 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| GLUT-2, GLUT2 Glucose transporter type 2, liver, SLC2A2, solute carrier family 2 (facilitated glucose transporter), member 2, solute carrier family 2, facilitated glucose transporter member 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATET | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto