missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HIF1AN Recombinant Protein

Brand: Abnova™ H00055662-P01.10ug

View more versions of this product

Product Code. 16131653

344.00€ / 10µg

Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso!

This item is not returnable. View return policy

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Numero di accesso	AAH07719.1
Formulazione	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecolare	64.13
Intervallo di pH	8
Metodo di purificazione	Glutathione Sepharose 4 Fast Flow
Quantità	10 μg
Immunogeno	MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Alias gene	DKFZp762F1811/FIH1/FLJ20615/FLJ22027
Simbolo del gene	HIF1AN
Specie	Wheat Germ (in vitro)
Tag proteine	GST

Da utilizzare con (applicazione)	Antibody Production, Protein Array, ELISA, Western Blot
ID gene (immissione)	55662
Nome	HIF1AN (Human) Recombinant Protein (P01)
Metodo di preparazione	In vitro wheat germ expression system
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Sorgente	Wheat Germ (in vitro)
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Nome comune	HIF1AN
Cross-reattività	Human
Recombinant	Recombinant
Forma	Solution

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

Abnova™ HIF1AN Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Promotions