missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ IL1RN (Human) Recombinant Protein
Human IL1RN full-length ORF ( AAH09745, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00003557-P01.10ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Specifica
AAH09745 | |
interleukin 1 receptor antagonist | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IL1RN | |
GST |
3557 | |
Wheat germ expression system | |
10 μg | |
ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto