missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MPPED2 (Human) Recombinant Protein
Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00000744-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Specifica
AAH31582 | |
metallophosphoesterase domain containing 2 | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
MPPED2 | |
GST |
744 | |
Wheat germ expression system | |
25 μg | |
239FB, C11orf8, D11S302E, FAM1B, Hs.46638, dJ1024C24.1, dJ873F21.1 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto