missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PSENEN Recombinant Protein
344.00€ - 521.00€
Specifica
| Numero di accesso | AAH09575 |
|---|---|
| Da utilizzare con (applicazione) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulazione | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID gene (immissione) | 55851 |
| Peso molecolare | 36.85 |
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantità | Prezzo | Quantità e disponibilità | |||||
|
16131893
|
Abnova™
H00055851-P01.10ug |
10 μg |
344.00€
10µg |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
|
16141893
|
Abnova™
H00055851-P01.25ug |
25 μg |
521.00€
25µg |
Effettua il login per acquistare questo articolo Hai bisogno di un conto web ? Registrati oggi stesso! | |||||
Descrizione
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
| AAH09575 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 36.85 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PSENEN | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 55851 | |
| PSENEN (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP | |
| MDS033/MSTP064/PEN-2/PEN2 | |
| PSENEN | |
| Wheat Germ (in vitro) | |
| GST |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto