missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SAA4 Recombinant Protein
Marca: Abnova™ H00006291-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Spécification
| AAH07026 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 40.04 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 μg | |
| MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY | |
| C-SAA/CSAA | |
| SAA4 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 6291 | |
| SAA4 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| SAA4 | |
| Human | |
| Recombinant | |
| Solution |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu