missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ SPDEF Recombinant Protein
Marca: Abnova™ H00025803-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifica
AAH21299 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
62.59 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 μg | |
MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI | |
PDEF/RP11-375E1__A.3/bA375E1.3 | |
SPDEF | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
25803 | |
SPDEF (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SPDEF | |
Human | |
Recombinant | |
Solution |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto