missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TBCB (Human) Recombinant Protein
Human TBCB full-length ORF ( AAH05969, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00001155-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Specifica
AAH05969 | |
tubulin folding cofactor B | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TBCB | |
GST |
1155 | |
Wheat germ expression system | |
25 μg | |
CG22, CKAP1, CKAPI, MGC14625 | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto