missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ ATP5G1 (Human) Recombinant Protein
Human ATP5G1 full-length ORF ( AAH04963, 18 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00000516-P01.25ug
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
- Sequence: TRGLIRPVSASFLSSPVNSSKQPSYSNFPLQVARREFQTSVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
Specifica
AAH04963 | |
ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9) | |
125% SDS-PAGE Stained with Coomassie Blue | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ATP5G1 | |
GST |
516 | |
Wheat germ expression system | |
25 μg | |
ATP5A, ATP5G | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto