missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Marca: Bio-Techne NBP3-10821-100UL
Questo articolo non è restituibile.
Consulta la politica di reso
Descrizione
BET1 Polyclonal specifically detects BET1 in Human samples. It is validated for Western Blot.
Specifica
| BET1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1 | |
| The immunogen is a synthetic peptide directed towards the middle terminal region of human BET1 (NP_005859.1). Peptide sequence IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 10282 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
BET1 Rabbit anti-Human, Polyclonal, Novus Biologicals™ > 100 μg; Unconjugated
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
