Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

1 – 15 di 52,969 risultati

Thermo Scientific™ Pierce™ Bovine Serum Albumin, Biotinylated

Purified biotin and biotinylated BSA, HRP, AP or FITC for use as controls or to amplify signal in IHC via the avidin-biotin complex (ABC).

Prezzi e disponibilità

ID gene (immissione)	167227
Immunogeno	METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Alias gene	FLJ33245/NUDT20
Specie	Wheat Germ (in vitro)
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Peso molecolare	68.09
Simbolo del gene	DCP2
Numero di accesso	AAH64593
Forma	Solution
Sorgente	Wheat Germ (in vitro)
Intervallo di pH	8
Cross-reattività	Human
Nome comune	DCP2
Da utilizzare con (applicazione)	Antibody Production,Protein Array,ELISA,Western Blot
Metodo di purificazione	Glutathione Sepharose 4 Fast Flow
Tag proteine	GST
Metodo di preparazione	In vitro wheat germ expression system
Nome	DCP2 (Human) Recombinant Protein (P01)
Formulazione	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Recombinant	Recombinant

Abnova™ Human TLR2 Partial ORF (AAH33756.1, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Promozioni disponibili

Prezzi e disponibilità
Specifiche

ID gene (immissione)	7097
Immunogeno	KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV
Sistema di espressione	wheat germ expression system
Alias gene	CD282/TIL4
Specie	Wheat Germ (in vitro)
Analisi di controllo qualità	12.5% SDS-PAGE Stained with Coomassie Blue.
Peso molecolare	36.63kDa
Simbolo del gene	TLR2
Numero di accesso	AAH33756.1
Forma	Liquid
Nome comune	TLR2
Da utilizzare con (applicazione)	Antibody Production,ELISA,Protein Array,Western Blot
Tag proteine	GST
Status giuridico	RUO
Nome	TLR2 (Human) Recombinant Protein (Q01)
Formulazione	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Requisiti di stoccaggio	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Recombinant	Recombinant

Corning™ Laminin, Mouse

Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth

Prezzi e disponibilità

Gibco™ Human Heat Stable bFGF Recombinant Protein

Recombinant Protein

Prezzi e disponibilità
Specifiche

Shipping Condition	Approved for shipment on Wet or Dry Ice
ID gene (immissione)	2247
Content And Storage	-20°C
Purity or Quality Grade	>95% by SDS-PAGE
Famiglia di proteine	Growth Factors and Receptors
Sistema di espressione	E. coli
Coniugato	Unconjugated
Classificazione	Carrier-Free
Concentrazione di endotossine	<1 EU/ μg
Attività biologica	ED50 = 0.6 - 1.1 ng/mL; determined by the dose-dependent proliferation of mouse NIH/3T3 fibroblast cells.
Alias gene	Basic fibroblast growth factor; basic fibroblast growth factor bFGF; bFGF; FGF; fgf basic; Fgf2; Fgf-2; Fgfb; FGF-b; Fibroblast growth factor; fibroblast growth factor 2; fibroblast growth factor 2 (basic); HBGF-2; Heparin-binding growth factor 2; H-FGF-b-147; H-FGF-b-154; M-FGF-b; Prostatic growth factor; prostatropin
Specie	Human
Peso molecolare	19 kDa
Numero di accesso	P09038
Forma	Lyophilized
Lunghezza della proteina	155 aa + 20 aa for N-terminal tag for purification purposes
Sterilità	Sterile
Livello di endotossine	<1 EU/μg
Product Type	Heat Stable Recombinant Human bFGF
Nome comune	FGF2
Da utilizzare con (applicazione)	Control,ELISA,Functional Assay,Immunohistochemistry,Western Blot
Research Category	Neurobiology, Oncology, Stem Cell Research, Microbiology, Differentiation, Angiogenesis
Nome	Human Heat Stable bFGF
Formulazione	20 mM potassium phosphate with 750 mM NaCl and no preservative
Recombinant	Recombinant

Gibco™ Human Granzyme B Recombinant Protein, PeproTech®

Recombinant Protein

Prezzi e disponibilità
Specifiche

ID gene (immissione)	3002
Content And Storage	-20°C
Purity or Quality Grade	≥ 95% by SDS-PAGE gel and HPLC analyses
Sistema di espressione	CHO cells
Coniugato	Unconjugated
Concentrazione di endotossine	<1 EU/ μg
Attività biologica	Determined by its ability to cleave chromogentic Granzyme B substrate IEPD-pNA
Alias gene	AI553453; C11; Cathepsin G-like 1; CCP1; CCP-1/C11; CCPI; CGL1; CGL-1; CSPB; CSP-B; Ctla1; Ctla-1; CTSGL1; cytotoxic cell protease 1; cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic T-lymphocyte-associated serine esterase 1; fragmentin; fragmentin 2; fragmentin-2; GLP I; GLP III; GLP-1; granzyme 2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); granzyme B(G,H); Granzyme-2; GranzymeB; granzyme-like protein 1; granzyme-like protein I; GRB; GZB; Gzmb; HLP; human lymphocyte protein; Human lymphocyte protein (Hlp); Lymphocyte protease; Natural killer cell protease 1; OTTHUMP00000028189; RNKP-1; SECT; T-cell serine protease 1-3 E
Sequenza	IIGGHEAKPH SRPYMAYLMI WDQKSLKRCG GFLIRDDFVL TAAHCWGSSI NVTLGAHNIK EQEPTQQFIP VKRPIPHPAY NPKNFSNDIM LLQLERKAKR TRAVQPLRLP SNKAQVKPGQ TCSVAGWGQT APLGKHSHTL QEVKMTVQED RKCESDLRHY YDSTIELCVG DPEIKKTSFK GDSGGPLVCN KVAQGIVSYG RNNGMPPRAC TKVSSFVHWI KKTMKRYHHH HHHHH
Formato	Lyophilized
Peso molecolare	26.6 kDa
Numero di accesso	P10144
Forma	Lyophilized
Nome comune	Granzyme B
Da utilizzare con (applicazione)	Functional Assay
Status giuridico	RUO
Nome	Human Granzyme B
Formulazione	protein with no preservative
Recombinant	Recombinant

Invitrogen™ Sambucus Nigra (Elderberry Bark) Lectin (SNA, EBL), fluorescein (FITC)

Bright-green SNA-fluorophor conjugate

Prezzi e disponibilità

Invitrogen™ Ovalbumin, Alexa Fluor™ 555 Conjugate

Labeled with bright, photostable and pH-insensitive Alexa Fluor 555 dye

Prezzi e disponibilità

Invitrogen™ Ovalbumin, Alexa Fluor™ 647 Conjugate

Labeled with bright, photostable and pH-insensitive Alexa Fluor 647 dye

Prezzi e disponibilità

Invitrogen™ Ovalbumin, Texas Red™ Conjugate

Labeled with bright, photostable and pH-insensitive Alexa Fluor 594 dye

Prezzi e disponibilità

Invitrogen™ Human EGF Recombinant Protein

Recombinant Protein

Prezzi e disponibilità
Specifiche

ID gene (immissione)	1950
Content And Storage	-20°Cor to +80°C if preferred
Purity or Quality Grade	≥95 % as determined by SDS-PAGE. ≥95 % as determined by SEC-HPLC.
Sistema di espressione	E. coli
Coniugato	Unconjugated
Attività biologica	1.iPSC-derived human vascular organoids (Day 7) were cultured with FGF2, Human EGF Recombinant Protein. Red arrows represent vascular organoids. Image taken (at 10 x magnification.(Routinely tested) 2.Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0.02-0.2 ng/mL)
Alias gene	AI790464; beta-urogastrone; EGF; Epidermal growth factor; epidermal growth factor (beta-urogastrone); epidermal growth factor precursor; H-EGF; HOMG4; Pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF); sb:eu639; URG; Urogastrone
Sequenza	Human EGF, amino acids Asn971-Arg1023 (Accession # NP_001954.2) with an N-terminal Met
Peso molecolare	6.3 kDa
Simbolo del gene	EGF
Numero di accesso	P01133
Forma	Lyophilized
Sorgente	E. coli
Nome comune	EGF
Da utilizzare con (applicazione)	ELISA,Functional Assay,Immunohistochemistry,Western Blot
Status giuridico	RUO
Nome	Human EGF
Formulazione	PBS with 0.01% Tween 80, 5% mannitol, 5% trehalose and no preservative; pH 7.4
Recombinant	Recombinant

Corning™ Ultrapure Laminin, Mouse

Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth

Prezzi e disponibilità

Invitrogen™ Human PIK3CB/PIK3R1 (p110 beta/p85 alpha), His Tag Recombinant Protein

Recombinant Protein

Prezzi e disponibilità
Specifiche

Shipping Condition	Dry Ice
ID gene (immissione)	5291, 5295
Content And Storage	-80°C, Avoid Freeze/Thaw Cycles
Famiglia di proteine	Kinases & Inhibitors
Sistema di espressione	Baculovirus
Coniugato	Unconjugated
Alias gene	PIK3CB; PIK3R1
Sequenza	Full length
Specie	Human
Quantità	20 μg
Peso molecolare	123.7-84.7 kDa
Numero di accesso	P27986, P42338
Forma	Liquid
Protein Form	Full Length, Recombinant, Active
Nome comune	PIK3CB/PIK3R1
Famiglia chinasi	PI3 Kinase
Da utilizzare con (applicazione)	Kinase Assay
Research Category	Signal Transduction, Drug Development, Oncology
Tag proteine	His-tag
Nome	Human PIK3CB/PIK3R1 (p110 beta/p85 alpha), His Tag
Formulazione	50 mM sodium phosphate with 0.1 mM PMSF, 0.25 mM DTT, 150 mM Imidazole, 25% glycerol, 300 mM NaCl and no preservative; pH 7
Concentrazione	See Label
Recombinant	Recombinant

Invitrogen™ Human ACE2 (aa1-615) Fc Chimera Recombinant Protein

Recombinant Protein

Prezzi e disponibilità
Specifiche

Peso molecolare	110 kDa
ID gene (immissione)	59272
Simbolo del gene	ACE2
Numero di accesso	Q9BYF1
Sorgente	HEK293 cells
Coniugato	Unconjugated
Alias gene	2010305L05Rik; ACE 2; Ace2; ACEH; ACE-related carboxypeptidase; angiotensin I converting enzyme (peptidyl-dipeptidase A) 2; angiotensin I converting enzyme 2; angiotensin-converting enzyme 2; Angiotensin-converting enzyme homolog; anigotensin I converting enzyme 2; anigotensin-converting enzyme-related carboxypeptidase; metalloprotease MPROT15; peptidyl-dipeptidase A; Processed angiotensin-converting enzyme 2; renal angiotensin-converting enzyme 2; UNQ868/PRO1885
Da utilizzare con (applicazione)	Control,ELISA,Western Blot
Status giuridico	RUO
Nome	Human ACE2 (aa1-615) Fc Chimera
Formulazione	PBS with no preservative
Concentrazione	1 mg/mL
Recombinant	Recombinant

Invitrogen™ Human PDK-1, His Tag Recombinant Protein

Recombinant Protein

Prezzi e disponibilità

Precedente
1
2
3
4
5
6
...
3,532
Successivo

Recombinant Proteins

Recombinant Proteins

Thermo Scientific™ Pierce™ Bovine Serum Albumin, Biotinylated

Abnova™ DCP2 Recombinant Protein

Abnova™ Human TLR2 Partial ORF (AAH33756.1, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal

Corning™ Laminin, Mouse

Gibco™ Human Heat Stable bFGF Recombinant Protein

Gibco™ Human Granzyme B Recombinant Protein, PeproTech®

Invitrogen™ Sambucus Nigra (Elderberry Bark) Lectin (SNA, EBL), fluorescein (FITC)

Invitrogen™ Ovalbumin, Alexa Fluor™ 555 Conjugate

Invitrogen™ Ovalbumin, Alexa Fluor™ 647 Conjugate

Invitrogen™ Ovalbumin, Texas Red™ Conjugate

Invitrogen™ Human EGF Recombinant Protein

Corning™ Ultrapure Laminin, Mouse

Invitrogen™ Human PIK3CB/PIK3R1 (p110 beta/p85 alpha), His Tag Recombinant Protein

Invitrogen™ Human ACE2 (aa1-615) Fc Chimera Recombinant Protein

Invitrogen™ Human PDK-1, His Tag Recombinant Protein

You recently viewed...Show

Risultati della ricerca filtrata

Recombinant Proteins

Recombinant Proteins

Filtra risultati

Corning™ Laminin, Mouse Greener Choice ProductThis product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More About the Greener Choice Program

Risultati della ricerca filtrata

Corning™ Laminin, Mouse