Recombinant Proteins

Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Specie
- (2)
- (11)
- (1,853)
- (99)
- (1)
- (1)
- (45)
- (8)
- (15)
- (1)
- (332)
- (1)
- (28,105)
- (1)
- (8)
- (3)
- (15)
- (1)
- (3)
- (6)
- (1)
- (7)
- (1)
- (3)
- (2)
- (3)
- (4)
- (3)
- (2)
- (4)
- (3)
- (3)
- (2)
- (1)
- (4)
- (1)
- (5,847)
- (196)
- (16)
- (15)
- (8)
- (4)
- (1)
- (3)
- (2)
- (6)
- (218)
- (4)
- (805)
- (1)
- (14)
- (53)
- (2)
- (2)
- (1)
- (42)
- (7)
- (44)
- (27)
- (2)
- (52)
- (128)
- (143)
- (13)
- (12)
- (2)
- (8)
- (2)
- (153)
- (4)
- (3)
- (3)
- (2)
- (2)
- (2)
- (14)
- (30,024)
- (4,492)
- (2)
- (4)
Da utilizzare con (applicazione)
- (2,769)
- (1)
- (28,533)
- (65)
- (4,604)
- (24)
- (1)
- (8)
- (2)
- (8)
- (2)
- (2)
- (2)
- (1)
- (2)
- (4)
- (2)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (248)
- (37)
- (1)
- (1)
- (28)
- (2)
- (48,675)
- (23)
- (2)
- (4)
- (28)
- (2)
- (687)
- (4)
- (3)
- (118)
- (71)
- (1,567)
- (3)
- (1)
- (7)
- (3)
- (19,644)
- (24)
- (30)
- (19)
- (1)
- (75)
- (15)
- (3)
- (77)
- (141)
- (89)
- (13)
- (4)
- (1)
- (137)
- (4)
- (1)
- (26)
- (11)
- (4)
- (1)
- (10)
- (10)
- (2)
- (4)
- (4,211)
- (4)
- (1)
- (1)
- (3)
- (47,862)
- (1)
- (62)
- (4)
- (5)
- (3)
- (6)
- (1)
- (1)
- (8,227)
- (4)
- (4)
- (1)
- (2)
- (4)
- (1)
- (1)
- (1)
- (48,341)
Recombinant
- (12)
- (38,394)
- (18)
Forma
- (3)
- (1)
- (26,395)
- (1,199)
- (3,660)
- (136)
- (16)
- (3,401)
Coniugato
- (2)
- (54)
- (1)
- (56)
- (4)
- (4)
- (1)
- (348)
- (1)
- (2)
- (2)
- (1)
- (1)
- (99)
- (3)
- (2)
- (2)
- (2)
- (1)
- (13)
- (666)
- (1)
- (1)
- (48)
- (13,088)
- (2)
- (2)

1
–
15
di
52,977
risultati
Thermo Scientific™ Pierce™ Bovine Serum Albumin, Biotinylated
Purified biotin and biotinylated BSA, HRP, AP or FITC for use as controls or to amplify signal in IHC via the avidin-biotin complex (ABC).

Fisher Scientific Edge
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
MP Biomedicals™ CellMaxx™ Bovine Albumin, Low Endotoxin, Stem Cell Culture
Lipid-rich bovine serum albumin, suitable for stem cell culture and media formulation

Fisher Scientific Edge
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
Peso molecolare | 66 |
---|---|
Forma | Powder |
Sorgente | Bovine |
Intervallo di pH | 6.5 to 7.5 |
Da utilizzare con (applicazione) | Mammalian Cell Culture |
Metodo di purificazione | Chromatography |
Nome | CellMaxx™ Bovine Albumin, Low Endotoxin |
Formulazione | Lipid-rich |
Requisiti di stoccaggio | 4°C |
Abnova™ DCP2 Recombinant Protein

Fisher Scientific Edge
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
ID gene (immissione) | 167227 |
---|---|
Immunogeno | METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL |
Alias gene | FLJ33245/NUDT20 |
Specie | Wheat Germ (in vitro) |
Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Peso molecolare | 68.09 |
Simbolo del gene | DCP2 |
Numero di accesso | AAH64593 |
Forma | Solution |
Sorgente | Wheat Germ (in vitro) |
Intervallo di pH | 8 |
Cross-reattività | Human |
Nome comune | DCP2 |
Da utilizzare con (applicazione) | Antibody Production,Protein Array,ELISA,Western Blot |
Metodo di purificazione | Glutathione Sepharose 4 Fast Flow |
Tag proteine | GST |
Metodo di preparazione | In vitro wheat germ expression system |
Nome | DCP2 (Human) Recombinant Protein (P01) |
Formulazione | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Requisiti di stoccaggio | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Recombinant | Recombinant |
Abnova™ Human TLR2 Partial ORF (AAH33756.1, 121 a.a. - 220 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re

Fisher Scientific Edge
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
Gli ordini eseguiti prima delle 14:00 saranno spediti oggi stesso.
Gli ordini eseguiti dopo le 14:00 saranno spediti domani.
Per saperne di più
ID gene (immissione) | 7097 |
---|---|
Immunogeno | KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDV |
Sistema di espressione | wheat germ expression system |
Alias gene | CD282/TIL4 |
Specie | Wheat Germ (in vitro) |
Analisi di controllo qualità | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Peso molecolare | 36.63kDa |
Simbolo del gene | TLR2 |
Numero di accesso | AAH33756.1 |
Forma | Liquid |
Nome comune | TLR2 |
Da utilizzare con (applicazione) | Antibody Production,ELISA,Protein Array,Western Blot |
Tag proteine | GST |
Status giuridico | RUO |
Nome | TLR2 (Human) Recombinant Protein (Q01) |
Formulazione | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Requisiti di stoccaggio | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Recombinant | Recombinant |
Corning™ Laminin, Mouse
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program

Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth
Shipping Condition | Approved for shipment on Wet or Dry Ice |
---|---|
ID gene (immissione) | 2247 |
Content And Storage | -20°C |
Purity or Quality Grade | >95% by SDS-PAGE |
Famiglia di proteine | Growth Factors and Receptors |
Sistema di espressione | E. coli |
Coniugato | Unconjugated |
Classificazione | Carrier-Free |
Concentrazione di endotossine | <1 EU/ μg |
Attività biologica | ED50 = 0.6 - 1.1 ng/mL; determined by the dose-dependent proliferation of mouse NIH/3T3 fibroblast cells. |
Alias gene | Basic fibroblast growth factor; basic fibroblast growth factor bFGF; bFGF; FGF; fgf basic; Fgf2; Fgf-2; Fgfb; FGF-b; Fibroblast growth factor; fibroblast growth factor 2; fibroblast growth factor 2 (basic); HBGF-2; Heparin-binding growth factor 2; H-FGF-b-147; H-FGF-b-154; M-FGF-b; Prostatic growth factor; prostatropin |
Specie | Human |
Peso molecolare | 19 kDa |
Numero di accesso | P09038 |
Forma | Lyophilized |
Lunghezza della proteina | 155 aa + 20 aa for N-terminal tag for purification purposes |
Sterilità | Sterile |
Livello di endotossine | <1 EU/μg |
Product Type | Heat Stable Recombinant Human bFGF |
Nome comune | FGF2 |
Da utilizzare con (applicazione) | Control,ELISA,Functional Assay,Immunohistochemistry,Western Blot |
Research Category | Neurobiology, Oncology, Stem Cell Research, Microbiology, Differentiation, Angiogenesis |
Nome | Human Heat Stable bFGF |
Formulazione | 20 mM potassium phosphate with 750 mM NaCl and no preservative |
Recombinant | Recombinant |
ID gene (immissione) | 3002 |
---|---|
Content And Storage | -20°C |
Purity or Quality Grade | ≥ 95% by SDS-PAGE gel and HPLC analyses |
Sistema di espressione | CHO cells |
Coniugato | Unconjugated |
Concentrazione di endotossine | <1 EU/ μg |
Attività biologica | Determined by its ability to cleave chromogentic Granzyme B substrate IEPD-pNA |
Alias gene | AI553453; C11; Cathepsin G-like 1; CCP1; CCP-1/C11; CCPI; CGL1; CGL-1; CSPB; CSP-B; Ctla1; Ctla-1; CTSGL1; cytotoxic cell protease 1; cytotoxic serine protease B; Cytotoxic T lymphocyte associated serine esterase 1; cytotoxic T-lymphocyte proteinase 2; cytotoxic T-lymphocyte-associated serine esterase 1; fragmentin; fragmentin 2; fragmentin-2; GLP I; GLP III; GLP-1; granzyme 2; granzyme B; granzyme B (granzyme 2, cytotoxic T-lymphocyte-associated serine esterase 1); granzyme B(G,H); Granzyme-2; GranzymeB; granzyme-like protein 1; granzyme-like protein I; GRB; GZB; Gzmb; HLP; human lymphocyte protein; Human lymphocyte protein (Hlp); Lymphocyte protease; Natural killer cell protease 1; OTTHUMP00000028189; RNKP-1; SECT; T-cell serine protease 1-3 E |
Sequenza | IIGGHEAKPH SRPYMAYLMI WDQKSLKRCG GFLIRDDFVL TAAHCWGSSI NVTLGAHNIK EQEPTQQFIP VKRPIPHPAY NPKNFSNDIM LLQLERKAKR TRAVQPLRLP SNKAQVKPGQ TCSVAGWGQT APLGKHSHTL QEVKMTVQED RKCESDLRHY YDSTIELCVG DPEIKKTSFK GDSGGPLVCN KVAQGIVSYG RNNGMPPRAC TKVSSFVHWI KKTMKRYHHH HHHHH |
Formato | Lyophilized |
Peso molecolare | 26.6 kDa |
Numero di accesso | P10144 |
Forma | Lyophilized |
Nome comune | Granzyme B |
Da utilizzare con (applicazione) | Functional Assay |
Status giuridico | RUO |
Nome | Human Granzyme B |
Formulazione | protein with no preservative |
Recombinant | Recombinant |
Invitrogen™ Sambucus Nigra (Elderberry Bark) Lectin (SNA, EBL), fluorescein (FITC)
Bright-green SNA-fluorophor conjugate
Invitrogen™ Ovalbumin, Alexa Fluor™ 555 Conjugate
Labeled with bright, photostable and pH-insensitive Alexa Fluor 555 dye
Invitrogen™ Ovalbumin, Alexa Fluor™ 647 Conjugate
Labeled with bright, photostable and pH-insensitive Alexa Fluor 647 dye
Invitrogen™ Ovalbumin, Texas Red™ Conjugate
Labeled with bright, photostable and pH-insensitive Alexa Fluor 594 dye
ID gene (immissione) | 1950 |
---|---|
Content And Storage | -20°Cor to +80°C if preferred |
Purity or Quality Grade | ≥95 % as determined by SDS-PAGE. ≥95 % as determined by SEC-HPLC. |
Sistema di espressione | E. coli |
Coniugato | Unconjugated |
Attività biologica | 1.iPSC-derived human vascular organoids (Day 7) were cultured with FGF2, Human EGF Recombinant Protein. Red arrows represent vascular organoids. Image taken (at 10 x magnification.(Routinely tested) 2.Measured in a cell proliferation assay using Balb/C 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0.02-0.2 ng/mL) |
Alias gene | AI790464; beta-urogastrone; EGF; Epidermal growth factor; epidermal growth factor (beta-urogastrone); epidermal growth factor precursor; H-EGF; HOMG4; Pro-epidermal growth factor; Pro-epidermal growth factor precursor (EGF); sb:eu639; URG; Urogastrone |
Sequenza | Human EGF, amino acids Asn971-Arg1023 (Accession # NP_001954.2) with an N-terminal Met |
Peso molecolare | 6.3 kDa |
Simbolo del gene | EGF |
Numero di accesso | P01133 |
Forma | Lyophilized |
Sorgente | E. coli |
Nome comune | EGF |
Da utilizzare con (applicazione) | ELISA,Functional Assay,Immunohistochemistry,Western Blot |
Status giuridico | RUO |
Nome | Human EGF |
Formulazione | PBS with 0.01% Tween 80, 5% mannitol, 5% trehalose and no preservative; pH 7.4 |
Recombinant | Recombinant |
Corning™ Ultrapure Laminin, Mouse
SureTRACE
Supporta la tracciabilità con accesso garantito ai certificati e notifiche tempestive in caso di cambiamenti.
Per saperne di più
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program

SureTRACE
Supporta la tracciabilità con accesso garantito ai certificati e notifiche tempestive in caso di cambiamenti.
Per saperne di più
Supporta la tracciabilità con accesso garantito ai certificati e notifiche tempestive in caso di cambiamenti.
Per saperne di più

Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”
Learn More About the Greener Choice Program
Promotes cell adhesion, migration, growth, and differentiation, including neurite outgrowth
Shipping Condition | Dry Ice |
---|---|
ID gene (immissione) | 5291, 5295 |
Content And Storage | -80°C, Avoid Freeze/Thaw Cycles |
Famiglia di proteine | Kinases & Inhibitors |
Sistema di espressione | Baculovirus |
Coniugato | Unconjugated |
Alias gene | PIK3CB; PIK3R1 |
Sequenza | Full length |
Specie | Human |
Quantità | 20 μg |
Peso molecolare | 123.7-84.7 kDa |
Numero di accesso | P27986, P42338 |
Forma | Liquid |
Protein Form | Full Length, Recombinant, Active |
Nome comune | PIK3CB/PIK3R1 |
Famiglia chinasi | PI3 Kinase |
Da utilizzare con (applicazione) | Kinase Assay |
Research Category | Signal Transduction, Drug Development, Oncology |
Tag proteine | His-tag |
Nome | Human PIK3CB/PIK3R1 (p110 beta/p85 alpha), His Tag |
Formulazione | 50 mM sodium phosphate with 0.1 mM PMSF, 0.25 mM DTT, 150 mM Imidazole, 25% glycerol, 300 mM NaCl and no preservative; pH 7 |
Concentrazione | See Label |
Recombinant | Recombinant |
Peso molecolare | 110 kDa |
---|---|
ID gene (immissione) | 59272 |
Simbolo del gene | ACE2 |
Numero di accesso | Q9BYF1 |
Sorgente | HEK293 cells |
Coniugato | Unconjugated |
Alias gene | 2010305L05Rik; ACE 2; Ace2; ACEH; ACE-related carboxypeptidase; angiotensin I converting enzyme (peptidyl-dipeptidase A) 2; angiotensin I converting enzyme 2; angiotensin-converting enzyme 2; Angiotensin-converting enzyme homolog; anigotensin I converting enzyme 2; anigotensin-converting enzyme-related carboxypeptidase; metalloprotease MPROT15; peptidyl-dipeptidase A; Processed angiotensin-converting enzyme 2; renal angiotensin-converting enzyme 2; UNQ868/PRO1885 |
Da utilizzare con (applicazione) | Control,ELISA,Western Blot |
Status giuridico | RUO |
Nome | Human ACE2 (aa1-615) Fc Chimera |
Formulazione | PBS with no preservative |
Concentrazione | 1 mg/mL |
Recombinant | Recombinant |